Product was successfully added to your shopping cart.
German war knife sword. For a Landsknecht mercenary or soldier.
German war knife sword. Sell edged Original pre-1945 Nazi relics and German militaria bought and sold. 00 Military Edged Weapon Auction. Jul 12, 2023 · Evolution and diversity of German swords, tracing their development from the medieval era to modern times, and uncovering their historical significance. Cleff specialized in producing: officer swords and sabers, honor and presentation swords, sidearms, bayonets and daggers. Langes messer ("long knife") was a one-handed, curved blade for civilian use. Broad type 18c blade diamond section with twisted pommel, quillons with side rings . It's one hell of a cutter! The hand forged sword is made from 1060 spring steel and features a very broad type 18c blade in a diamond section with typical twisted pommel and quillons with two side rings for great hand protection and also with a twisted motif. Military Edged Weapon Auction. Jul 20, 2025 · The Kriegsmesser, or “war knife”, was a large, single-edged European sword used primarily in the German-speaking regions during the late Middle Ages and Renaissance. Civil War, the Napoleonic Wars, the American Revolutionary War and earlier. Vintage German Military Edged Weapons – Authentic WWI & WWII Daggers, Swords & Bayonets Explore our premium collection of Vintage German Military Edged Weapons, featuring authentic WWI and WWII-era daggers, swords, bayonets, and fighting knives used by the German military. Late 15th century – German. We buy and sell WWII German daggers, swords, uniforms, helmets, hats, medals, badges, flags and more! German war sword from 1500. WW2 Nazi German Hitler Youth 'HJ' Dagger RZM Marked M7/93 (Ewald Cleff, Solingen) & Scabbard With Integral Frog. , Germany, Japan, Russia, Britain, Poland, and India. Cleff also did German war sword from 1500. 00 Item Number: 77164 Jul 8, 2024 · Although sword was fairly accessible as sidearm even to the common people during the High and Late Middle Ages, it was not exclusively the most widespread sidearme — at least not in the territory of the Bohemian Kingdom and the adjacent German-speaking regions of the Holy Roman Empire. Our collection of WWII Era Reproduction Military Knives, Daggers, Swords, and Bayonets features a wide variety of styles and designs, including replicas from the U. This design (one of the 2010 Sword Buyer’s Guide Designer Contest Winners) is no exception. World War II era early German Officer’s Dagger with General’s Hangers $ 800. Our carefully curated selection features daggers from the Kriegsmarine (Navy), Heer (Army), Luftwaffe (Air Force), SS, Hitler Jugend (HJ – Hitler Youth), Reichsarbeitsdienst (RAD), Deutscher Luftsportverband Explore replica knives from WWII and more. World War II German naval dress dagger, 36cm long, brand new, die casting, pointed, unsharpened; Stainless steel blade, 22cm long, 2cm wide, 12cm handle, dual fullers on each of both sides, White hard ABS plastic scabbard and handle with a flying eagle on the gold cross guard and a resting eagle at the gold pommel; Please advise if you are also interested in other daggers. Shop authentic-style war knife, daggers, and swords from the 20th century at Atlanta Cutlery. The German Gross Messer has a reputation for being a huge and imposing battle-ready sword. Darksword Armory’s Knochenbrecher (German for “Bone Breaker”) is based on the Kriegsmesser, meaning “war knife,” the large and imposing weapon of the 15th-century. These were around 40” long and weighed about two to three pounds. The following section provides several, high detailed pictures of various German blades. It registered with the Solingen commercial authorities on April 14, 1885. A. S. Due to the high quality, design and rarity these blades have become very desirable and might be second only to the legendary Samurai sword. May 22, 2022 · Guide to famous German swords throughout history, including famous German swords during the Middle Ages, 1800's, and World War II. Buy Civil War, WWI, WWII, Vietnam fighting knife, sword, dagger, bayonet, katana. Global shipping. Messer are characterized by single-edged blades mounted on knife-like hilts. Over time, they became distinctive, deadly, and beautiful weapons associated with the Germanic peoples. Messer are characterized by single-edged blades mounted on knife-like hilts. The lengths and shape of blades can vary greatly, with straight or curved profiles, broad or narrow blades, and presence or absence of fullers. 1944 Militaria proudly offers a premier collection of original Third Reich and German WWII-era edged weapons, including daggers, bayonets, dagger hangers, gravity knives, and swords. Explore a collection of German World War II edged weapons, including daggers and swords, available for purchase at Griffin Militaria. Oct 14, 2023 · Explore the fascinating history of German Swords, their characteristics, and learn how they were used both on and off the battlefield. . iBuyWorldWar2. Despite its humble status, the Messer was a formidable weapon Customs Service Daggers (3) Diplomatic and Government Official Daggers (2) DLV Flyers Daggers and Knives (2) Fire Official and Water Protection Police Daggers (1) Forestry Service Cutlasses (11) Hitler Youth and German Youth (HJ/DJ) Daggers and Knives (6) Hunting Association Daggers (7) Luftwaffe Daggers (35) Miscellaneous Knives (5) Navy Daggers (11) Army Officer Daggers (34) NPEA Daggers (2 We buy all kinds of foreign and domestic military items, including: German Daggers, German Medals, Helmets, Belt Buckles, Flags, Uniforms and much much more! We strive to make it simple and easy for you to turn your items into cash fast! The German armed forces have a dagger, knife or sword for just about every branch and occasion. We buy and sell WWII German daggers, swords, uniforms, helmets, hats, medals, badges, flags and more! Introduction The messer was very popular in Germany and was subdivided into two types to better differentiate between its various uses. A stellat selection of daggers, bayonets, swords & knives at the War Front Portland, Seattle &online. com - Buyer & Seller of German SS daggers, Heer Army daggers, Luftwaffe daggers, Navy daggers, and other WW2 military collectibles. Original pre-1945 Nazi relics and German militaria bought and sold. Sn 22755 - 22755 The Ewald Cleff Waffenfabrik company began in 1867. German War Academy Prize Presentation Lion Head Damascus Sword $ 3,200. More commonly referred to as a Viking sword, the Ulfberht sword was actually crafted by Frankish bladesmiths. [1] Kriegsmessers ("war knife") were made for professional soldiers and were very popular with German infantry Apr 25, 2025 · The Messer (German for “knife”) is a distinctive single-edged sword that originated in Central Europe, particularly in Germanic regions during the late Middle Ages (14th–16th centuries). Sell edged German war sword from 1500. That… Antique Swords for sale from International Military Antiques, including swords from WWII, WWI, Victorian, U. May 2024. Its unique classification as a large knife rather than a traditional sword made it legally accessible to civilians and non-noble warriors. These high-quality replicas are made with attention to detail and crafted with materials that The Ulfberht sword is one of the most famous swords in early German history and one of the most famous swords in general. For a Landsknecht mercenary or soldier. M1 Garand Bayonets, machetes, German daggers for sale. Gross Messers (German for “Great Knife”) look like scaled up versions of the classic “Bowie” style hunting knife, were commonly seen during the later parts of the 15th WWII Era Military Knives, Daggers, Swords and Bayonets and Decorative Replicas. Bid online. xggamcjcyqhvaodvsvhxzwfmtnshtwtigcypptcyknnklgaklnyapku